SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075R3P5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A075R3P5
Domain Number - Region: 26-82
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 0.017
Family Small-conductance potassium channel 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075R3P5
Sequence length 92
Comment (tr|A0A075R3P5|A0A075R3P5_BRELA) Uncharacterized protein {ECO:0000313|EMBL:AIG26494.1} KW=Complete proteome; Reference proteome OX=1042163 OS=Brevibacillus laterosporus LMG 15441. GN=BRLA_c021730 OC=Brevibacillus.
Sequence
MKKSTAKRILRDYPEFEAWLKQQPTRVARVLSNPATMDKYLEQWEKEKKRQQRTSLASLV
NLQSISEKTRKVNEKLTSLQSILDVISDNKKI
Download sequence
Identical sequences A0A075R3P5 H0UAC6
WP_003337357.1.38728 WP_003337357.1.44638 WP_003337357.1.51389 WP_003337357.1.89784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]