SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075RC10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A075RC10
Domain Number - Region: 111-171
Classification Level Classification E-value
Superfamily Prefoldin 0.0915
Family Prefoldin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075RC10
Sequence length 172
Comment (tr|A0A075RC10|A0A075RC10_BRELA) Uncharacterized protein {ECO:0000313|EMBL:AIG27035.1} KW=Complete proteome; Reference proteome OX=1042163 OS=Brevibacillus laterosporus LMG 15441. GN=BRLA_c027160 OC=Brevibacillus.
Sequence
MLEYESDFAMKKKHEHILLSYLYNDHSELDGKLKHILSLIRYGTKWNEALHEDLHRFLQF
LQTDFRRHIMVEDDILFFTLTSRLATLEEPLLLIKSEHDRLLEISDRIGTELNQCVQLEQ
KTSTMVCLLKQFDELFEEHTIKEDRVLYPMANKLLTLAEKDSLYQTISKHYK
Download sequence
Identical sequences A0A075RC10 H0U754
WP_003336135.1.38728 WP_003336135.1.51389 WP_003336135.1.89784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]