SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075T3M5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075T3M5
Domain Number 1 Region: 4-131
Classification Level Classification E-value
Superfamily PX domain 1.05e-24
Family PX domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075T3M5
Sequence length 235
Comment (tr|A0A075T3M5|A0A075T3M5_9TELE) SH3 and PX domain-containing 3-like protein {ECO:0000313|EMBL:AIG52183.1} OX=111846 OS=Notropis blennius (river shiner). GN=SH3PX3 OC=Cyprinidae; Notropis.
Sequence
SYTIEMGPRGPQWKESPQPFSCSIEDPTKQTKFKGIKTYISYRLTPSHIARPVYRRYKHF
DWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIDKRKRRLILWMDHMTSHPVLSQYEGFE
HFLMCTDDKQWKLGKRRAEKDEMVGAHFMLTFQIPNEHQDLQDVEERIDTFKAFAKKMDD
SVMQLTHVASELVRKHLGGFRKEFQRLGNGFQSISQSFLLDPPYSSDALSNAISH
Download sequence
Identical sequences A0A075T3L4 A0A075T3M5 A0A075T6R3 A0A075T7L9 A0A075T7N9 A0A075T7S4 A0A075T8V0 A0A075TDT5 A0A075TDU9 A0A075TDW8 F8UX03 F8UX04

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]