SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075TL81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075TL81
Domain Number 1 Region: 113-177
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 2.46e-16
Family Neurotrophin 0.0000749
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075TL81
Sequence length 178
Comment (tr|A0A075TL81|A0A075TL81_STUTI) Brain-derived neurotrophic factor {ECO:0000256|RuleBase:RU364086} OX=27661 OS=Sturnira tildae (Tilda's yellow-shouldered bat). GN=bdnf OC=Phyllostomidae; Stenodermatinae; Sturnira.
Sequence
CMKAAPMKEANVRGQGSLAYPGVRTHGTLESVNGPKANSRGLTSLADTFEHVIEELLDED
QKARPQEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPAR
RGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYT
Download sequence
Identical sequences A0A075TL81 A0A0K0N4X6 A0A0K0N544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]