SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075TYP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A075TYP9
Domain Number - Region: 7-72
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0301
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A075TYP9
Sequence length 92
Comment (tr|A0A075TYP9|A0A075TYP9_9LACT) UPF0473 protein WS74_0407 {ECO:0000256|HAMAP-Rule:MF_01448} KW=Complete proteome; Reference proteome OX=759620 OS=Weissella ceti. GN=WS74_0407 OC=Weissella.
Sequence
MSNVNEEQDIISLFNEQGDEELFEVLFSFHDDDYNKDYIFVYPAGADLDEGVDIFPFIVN
SKDTEGTFDEIEDDAEFEMVSEALNRYLDEAE
Download sequence
Identical sequences A0A075TYP9
WP_009765495.1.16602 WP_009765495.1.21627 WP_009765495.1.37651 WP_009765495.1.86195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]