SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075UML0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075UML0
Domain Number 1 Region: 12-145
Classification Level Classification E-value
Superfamily BH3703-like 0.00000000000000115
Family BH3703-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075UML0
Sequence length 149
Comment (tr|A0A075UML0|A0A075UML0_9PSEU) Uncharacterized protein {ECO:0000313|EMBL:AIG73819.1} KW=Complete proteome OX=208439 OS=Amycolatopsis japonica. GN=AJAP_04485 OC=Amycolatopsis.
Sequence
MTIPAKFGDVDQERILTEIADQLKFLLPPGWDYVQIKYNAIGDYRETAAIVRSVAETLTP
WTPPEVIADLFAELRAGAANPVGGTWLGAVFEMRHPGSFRVNFNGTAEPEFRNPPPAEAF
AEELRRFPRADENIPDWLRLRADEAGDAS
Download sequence
Identical sequences A0A075UML0
WP_051972339.1.1574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]