SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075VSP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075VSP4
Domain Number 1 Region: 68-113,214-319,346-510
Classification Level Classification E-value
Superfamily gp120 core 1.1e-90
Family gp120 core 0.00000579
Further Details:      
 
Domain Number 2 Region: 561-681
Classification Level Classification E-value
Superfamily Virus ectodomain 5.01e-49
Family Virus ectodomain 0.000000668
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075VSP4
Sequence length 887
Comment (tr|A0A075VSP4|A0A075VSP4_SIV) Transmembrane protein gp41 {ECO:0000256|RuleBase:RU363095} OX=11723 OS=Simian immunodeficiency virus (SIV). GN=env OC=Lentivirus; Primate lentivirus group. OH=9598
Sequence
MGCLGNQLLIAILLLSAYGIYCAHYVTVFYGVPAWRNATVPLFCATKNRDTWGTTQCLPD
NDDYTELAINVTESFDAWDNTVTEQAIEDVWNLFETSIKPCVKLTPLCIAMRCNKTETDK
WGLTRNATATTATTTSTTTTTPNVTAKVINESNPCIKNNSCEGLEQEPMVSCKFNMTGLK
RDKKKEYNETWYSRDLVCEQSTNESESKCYMNHCNTSVIQESCDKHYWDAIRFRYCAPPG
YALLRCNDSNYSGFAPNCSKVVVSSCTRMMETQTSTWFGFNGTRAENRTYIYWHGKRNST
IISLNKYYNLTIRCRRPGNKTVLPVTIMSGLVFHSQPINERPKQAWCWFGGSWRKAIQEV
KETIVKHPRYTGTNDTNKINLTAPGGGDPEVTFMWTNCRGEFLYCKMNWFLNWVEDRNTS
HPRWTQQKDKERKKRNYVPCHIRQIINTWHKVGKNVYLPPREGDLTCNSTVTSLMANIEW
INNNETNITMGADVAELYRLELGDYKLVEITPIGLAPTTVRRYTTTGASRNKRGVFVLGF
LGFLATAGSAMGAASLTLSAQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTR
VTAIEKYLKDQAQLNSWGCAFRQVCHTTVPWPNETLLPNWNNMTWQEWEKQVNFLEANIT
QLLEEAQIQQEENMYELQKLNSWDVFGNWFDLTSWIKYIQYGVFIVLGVIGLRIVIYVVQ
MLARLRQGYRPVFSSPPAYVQQIPIRKGQEQPTKEGEEEDGGDRGGSRSWPWQIEYIHFL
IRQLIRPWTWLSTTCRTYLLRIYQILQTVFQRLFSAVQRIQEVIRTEISYLQYGCRWFQE
AVRAAWRATRETLASAWRDLWETLGRVGRGILAIPRRIRQGLEITLL
Download sequence
Identical sequences A0A075VSP4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]