SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075WSM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075WSM8
Domain Number 1 Region: 9-145
Classification Level Classification E-value
Superfamily Ribosomal protein L13 7.19e-55
Family Ribosomal protein L13 0.00000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A075WSM8
Sequence length 148
Comment (tr|A0A075WSM8|A0A075WSM8_9BACT) 50S ribosomal protein L13 {ECO:0000256|HAMAP-Rule:MF_01366, ECO:0000256|RuleBase:RU003878, ECO:0000256|SAAS:SAAS00725370} KW=Complete proteome; Reference proteome OX=289377 OS=Thermodesulfobacterium commune DSM 2178. GN=HL41_05630 OC=Thermodesulfobacteriaceae; Thermodesulfobacterium.
Sequence
MSSVLTPQTPWVKKEEVKREWYLVDAKDKVLGRLASKIATLLQGKNRPDYTPHVDQADFI
VVINAEKVKLTGKKLEQKVYWRHTGYMGGLKLETAKQLLAKDPAKVILLAVKRMLPRNRM
RKKLLKKLKIYAGSTHPHIAQNPKPLDL
Download sequence
Identical sequences A0A075WSM8 A0A101FID3
WP_038062849.1.38988 WP_038062849.1.5703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]