SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076E7G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076E7G1
Domain Number 1 Region: 19-112
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 1.27e-17
Family Chemosensory protein Csp2 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A076E7G1
Sequence length 115
Comment (tr|A0A076E7G1|A0A076E7G1_9NEOP) Chemosensory protein {ECO:0000313|EMBL:AII01027.1} OX=765132 OS=Dendrolimus houi. GN=CSP17 OC=Bombycoidea; Lasiocampidae; Dendrolimus.
Sequence
MKSFIILSCVVVLAFAQKYSGKLDSVDIKELFENDSMKTNIFNCFTEKGTCAPEFQEIKD
LLTNPSTIDDNLSEAQLEKFKDAAKYMHEKYRSVYDELAAKNDPTGQWRKKYGLP
Download sequence
Identical sequences A0A076E7G1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]