SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076E961 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076E961
Domain Number 1 Region: 24-121
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 1.96e-36
Family Chemosensory protein Csp2 0.0000405
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A076E961
Sequence length 139
Comment (tr|A0A076E961|A0A076E961_9NEOP) Chemosensory protein {ECO:0000313|EMBL:AII01023.1} OX=765132 OS=Dendrolimus houi. GN=CSP13 OC=Bombycoidea; Lasiocampidae; Dendrolimus.
Sequence
MNFIIITSFVIFQIFIINGEETSYTNEFDGLDLHEILTNNRLLTAYVNCLLENGPCTPDG
KELKKNLPDAIDNGCKKCTQKQREGADEVMHYIIDNRPEDWTKLEDKYHSDGTYKRKYLA
SKQVMGEPQDNNSTQNAAT
Download sequence
Identical sequences A0A076E961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]