SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076EDN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076EDN1
Domain Number 1 Region: 2-81
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 3.92e-17
Family PG0164-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A076EDN1
Sequence length 146
Comment (tr|A0A076EDN1|A0A076EDN1_RHOOP) Uncharacterized protein {ECO:0000313|EMBL:AII04375.1} KW=Complete proteome OX=37919 OS=Rhodococcus opacus (Nocardia opaca). GN=EP51_07135 OC=Rhodococcus.
Sequence
MRFRTTIELGGKTATGFRIPEDVVAELGSGKRPAVRVTIGGHTYRTTVAPMGGVFMIPLS
AENRAGAGVAAGDEVDVDVELDSEPRVVTVPPDFAAALDREPDARTAFDALSYNNQRRHV
LSIEGAKTDETRQRRIGKAVDALRQG
Download sequence
Identical sequences A0A076EDN1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]