SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076HJ29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076HJ29
Domain Number 1 Region: 39-75
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 0.000000157
Family Chlorophyll a-b binding protein 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A076HJ29
Sequence length 83
Comment (tr|A0A076HJ29|A0A076HJ29_9SYNE) High light inducible protein {ECO:0000313|EMBL:AII47559.1} KW=Complete proteome OX=585425 OS=Synechococcus sp. KORDI-52. GN=KR52_07185 OC=Synechococcus.
Sequence
MSQSSSSNPVVRGATVTMEDGGRLNAFATEPRMEVVEAEQGWGFHDRAEKLNGRMAMLGF
ISLLATELALGGESFVHGLLGLG
Download sequence
Identical sequences A0A076HJ29
WP_038553946.1.28472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]