SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076N0I7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076N0I7
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily ISP domain 2.88e-30
Family Rieske iron-sulfur protein (ISP) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A076N0I7
Sequence length 106
Comment (tr|A0A076N0I7|A0A076N0I7_AMYME) Phenylpropionate dioxygenase ferredoxin subunit {ECO:0000313|EMBL:AIJ24586.1} KW=Complete proteome; Reference proteome OX=1068978 OS=Amycolatopsis methanolica 239. GN=AMETH_4494 OC=Amycolatopsis.
Sequence
MISVCALQDLPVGEAVRIEAEVPIAVFNVDGTLYAIDDTCTHQDASLADGWLDGCAVECP
LHAACFDLRTGMPSGPPAKKPVRTHEVVVVDGQIYVNVNAPQRMGV
Download sequence
Identical sequences A0A076N0I7
WP_017983415.1.21974 WP_017983415.1.5303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]