SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076NQ18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076NQ18
Domain Number 1 Region: 7-94
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-28
Family Chaperone J-domain 0.00031
Further Details:      
 
Domain Number 2 Region: 285-365
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 2.88e-21
Family HSP40/DnaJ peptide-binding domain 0.0017
Further Details:      
 
Domain Number 3 Region: 162-237
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 1.06e-16
Family DnaJ/Hsp40 cysteine-rich domain 0.00026
Further Details:      
 
Domain Number 4 Region: 141-180,240-288
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 3.27e-16
Family HSP40/DnaJ peptide-binding domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A076NQ18
Sequence length 392
Comment (tr|A0A076NQ18|A0A076NQ18_9CORY) Chaperone protein DnaJ {ECO:0000256|HAMAP-Rule:MF_01152} KW=Complete proteome; Reference proteome OX=156978 OS=Corynebacterium imitans. GN=CIMIT_10665 OC=Corynebacterium.
Sequence
MAMQQEWANKDYYGDLGVSSSASAADIKKAYRKLARENHPDSNPGNKAAEEKFKRVAEAY
DVLGNEQERKEYDQFKSMMGSGGFGRFGGGGSGFPGGFRTTQTDFSDVFGHPGAGQAGDG
GLGDLFGGLFNRGGAAGRNARPSRGADVETEITLDFREAAKGTTFPVELTGEAPCTTCHG
SGSKDGKTHRCGTCSGSGYVRENSGAFGMARPCAECQGTGEIIEDPCTTCHGTGTVRRTR
SITVRIPAGVIDGQKVRLAGQGEAGPNGTPAGDLFVHVHVREDAVFTRSGDDLEVTVPVS
FGELALGGTVTVPTLEKRVRVKIPAGTPNGRTLRVKGRGVPRKSGKAGDLLVTVEVAVPK
DLDAAATSALRAYHQAERDSGFDPRAGWAGNQ
Download sequence
Identical sequences A0A076NQ18
WP_038592675.1.1504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]