SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076PZK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076PZK3
Domain Number 1 Region: 2-189
Classification Level Classification E-value
Superfamily VC0467-like 2.09e-59
Family VC0467-like 0.00000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A076PZK3
Sequence length 190
Comment (tr|A0A076PZK3|A0A076PZK3_COMTE) UPF0301 protein O987_24175 {ECO:0000256|HAMAP-Rule:MF_00758} KW=Complete proteome OX=1392005 OS=Comamonas testosteroni TK102. GN=O987_24175 OC=Comamonadaceae; Comamonas.
Sequence
MTHHFLIAMPGLEDESFSRSVVYLCEHSERGALGLIINKPSKLSLQGLLQKVDLGLKRDD
LRDQQVFTGGPVQTDRGFVLHEPMVIEGAPENESAYASTMTIPGGLEMTTSKDVLEALSD
GAGPKRVLVTLGYSSWDEGQLESEIGENAWLTVEADPEVIFSTPVDERYDRALGLLGLQR
WMLSPESGRA
Download sequence
Identical sequences A0A076PZK3 A0A1Y1J0D5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]