SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076U7D3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076U7D3
Domain Number 1 Region: 131-289
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 3.14e-80
Family Retrovirus capsid protein, N-terminal core domain 0.0000000383
Further Details:      
 
Domain Number 2 Region: 2-136
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 5.49e-63
Family Immunodeficiency virus matrix proteins 0.000000554
Further Details:      
 
Domain Number 3 Region: 280-361
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.01e-32
Family Retrovirus capsid protein C-terminal domain 0.0000118
Further Details:      
 
Domain Number 4 Region: 379-430
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 1.51e-16
Family Retrovirus zinc finger-like domains 0.0000337
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A076U7D3
Sequence length 500
Comment (tr|A0A076U7D3|A0A076U7D3_9HIV1) Gag polyprotein {ECO:0000256|RuleBase:RU004487, ECO:0000256|SAAS:SAAS00998370} OX=11676 OS=Human immunodeficiency virus 1. GN= OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLESSEGCRQI
LGQLQPXLQTGSEELKSLYNTVATLYCVHQKIEIKDTKEALEKIEEEQNKSKKKAQQAAA
DXGNXXQVSQNYPIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGAT
PQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTT
STLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRF
YKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKA
RXLAEAMSQVTNSATIMMQKGNFRNQRKXVKCFNCGKEGHIAKNCRAPRKKGCWKCGXEG
HQMKDCTERQANFLGKIWPSHKGRPGNFLQXRPEPTAPPEESFRFGEETTTPXQKQEPID
RELYPLASLKSLFGNDPSSQ
Download sequence
Identical sequences A0A076U7D3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]