SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076U7U5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076U7U5
Domain Number 1 Region: 135-293
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 3.41e-80
Family Retrovirus capsid protein, N-terminal core domain 0.0000000451
Further Details:      
 
Domain Number 2 Region: 2-140
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 3.14e-62
Family Immunodeficiency virus matrix proteins 0.000000732
Further Details:      
 
Domain Number 3 Region: 284-366
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.13e-33
Family Retrovirus capsid protein C-terminal domain 0.0000124
Further Details:      
 
Domain Number 4 Region: 383-434
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 1.98e-17
Family Retrovirus zinc finger-like domains 0.0000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A076U7U5
Sequence length 504
Comment (tr|A0A076U7U5|A0A076U7U5_9HIV1) Gag polyprotein {ECO:0000256|RuleBase:RU004487, ECO:0000256|SAAS:SAAS00998370} OX=11676 OS=Human immunodeficiency virus 1. GN= OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MGARASVLSGGELDKWEKIRLRPGGRKKYQLKHIVWASRELERFAVNPGLLETAEGCXQI
LGQLQPSLQTGSEELRSLFNTIATLYCVHQKIEIKDTKEALEKIEEEQAKSKKKAQQAAQ
QAAADTGNSSXVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALS
EGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDI
AGTTSTLQEQINWMTGNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDY
VDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCRTILKALGPAATLEEMMTACQGVGGP
GHKARVLAEAMSQVTNSATVMMQKGNFRSQRKIVKCFNCGKEGHIARNCRAPRKKGCWKC
GKEGHQMKDCNERQANFLGKIWPSHKGRPGNFLQSRPEPTAPPEESFRFGEGTTTPSQKQ
EQIDKDLYPSASLRSLFGNDPLSQ
Download sequence
Identical sequences A0A076U7U5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]