SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076UCU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076UCU1
Domain Number 1 Region: 129-287
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 2e-79
Family Retrovirus capsid protein, N-terminal core domain 0.0000000436
Further Details:      
 
Domain Number 2 Region: 2-134
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 7.85e-62
Family Immunodeficiency virus matrix proteins 0.000000907
Further Details:      
 
Domain Number 3 Region: 279-360
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 9.71e-33
Family Retrovirus capsid protein C-terminal domain 0.0000118
Further Details:      
 
Domain Number 4 Region: 377-428
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 3.95e-17
Family Retrovirus zinc finger-like domains 0.0000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A076UCU1
Sequence length 498
Comment (tr|A0A076UCU1|A0A076UCU1_9HIV1) Gag polyprotein {ECO:0000256|RuleBase:RU004487, ECO:0000256|SAAS:SAAS00998370} OX=11676 OS=Human immunodeficiency virus 1. GN= OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MGARASVLSGGQLDKWERIRLRQGGKKKYQLKHIVWASRELERFAVNPGLLETSEGCRQI
LGQLQPSLQTGSEELKSLYNTVATLYCVHQKIDVRDTKEALEKIEEEQNKSKKKQAAADT
GNSSKVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQ
DLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSN
LQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPSSILDIRQGPKEPFRDYVDRFYK
TLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARV
LAEAMSQVTNSATIMMQKGNFRNQRKIVKCFNCGKEGHIAKNCRAPRKRGCWKCGKEGHQ
MKDCTERQANFLGKIWPSYKGRPGNFLQSRPEPTAPPEESFRFGEETTTPSQKQESIDKE
LHPLASLRSLFGNDPSSQ
Download sequence
Identical sequences A0A076UCU1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]