SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076V4M2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076V4M2
Domain Number 1 Region: 156-484
Classification Level Classification E-value
Superfamily gp120 core 2.45e-166
Family gp120 core 0.000000000341
Further Details:      
 
Domain Number 2 Region: 532-654
Classification Level Classification E-value
Superfamily Virus ectodomain 5.87e-58
Family Virus ectodomain 0.00000601
Further Details:      
 
Domain Number 3 Region: 84-134
Classification Level Classification E-value
Superfamily gp120 core 0.00000000000000824
Family gp120 core 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A076V4M2
Sequence length 853
Comment (tr|A0A076V4M2|A0A076V4M2_9HIV1) Glycoprotein 120 {ECO:0000256|HAMAP-Rule:MF_04083} KW=Complete proteome OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MRVMEIKRNCQPFWKWGIMLLGMLMISSATXKWWVTVYYGVPVWRDANTTLFCASDARAT
QTEAHNIWATHACVPTDPNPQEVKLENVTENFNMWKNNMVEQMHEDIIELWDQSLKPCVK
LTPLCVILSCTNLNNTNSSSTNSTNSSSWGEIKEGEIKNCSFNITRSIGKRRPQKDYALF
NALDVVPISNDSESYMLINCNTSVITQACPKITFEPIPIHYCAPAGFAILKCNNDSFNGT
GPCTNVSTVQCTHGIKPVVSTQLLLNGSLAEKEVVIRSENFTNNAKTILVHLKEPVEIKC
TRPNNNTRRSIQVGPGKALYATGEIIGDIRQAHCNLSMAGWNNTLKQIVGKLRVQFKNKT
IQFTQPSGGDPEIIMHTFNCGGEFFYCNTTQLFNSTWXTDNTTIILPCRIKQIINRWQGV
GKAMYAPPISGIIKCSSNITGLLLTRDGGNTNEANDTEIFRPGGGDMRDNWRSELYKYKV
VKIEPLGVAPTRAKRRVVQREKRAVTLGAMFLGFLGAAGSTMGAASMTLTVQARQLLSGI
VQQQNNLLRAIEAQQHLLQLTVWGIKQLQARVLAVERYLKDQQLLGIWGCSGKLICTTTV
PWNASWSNKSLDDIWNNMTWMEWDREVNNYTSLIYSLIEESQNQQEKNEQELLAQELLAL
DKXASLXNXFDISKWLWYIRIFIMIVGGLVGLRIVFTILSLVNRVRQXYSPLSFQTRLPA
PRGPDRPEGTEEESGERDRDRSETLATGFLALIWVDLRSLCLFSYHRLRDLLWIVARIVE
LLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNAIAIAVAEGTDRIIEGAQRIGRAFLHI
PRRIRQGLERALL
Download sequence
Identical sequences A0A076V4M2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]