SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076V4T0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076V4T0
Domain Number 1 Region: 146-434
Classification Level Classification E-value
Superfamily gp120 core 1.86e-141
Family gp120 core 0.00000000235
Further Details:      
 
Domain Number 2 Region: 482-607
Classification Level Classification E-value
Superfamily Virus ectodomain 5.26e-58
Family Virus ectodomain 0.00000854
Further Details:      
 
Domain Number 3 Region: 83-142
Classification Level Classification E-value
Superfamily gp120 core 0.0000000000000259
Family gp120 core 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A076V4T0
Sequence length 798
Comment (tr|A0A076V4T0|A0A076V4T0_9HIV1) Transmembrane protein gp41 {ECO:0000256|RuleBase:RU363095} KW=Complete proteome OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MRVRGMQRNWQHXGTWGLLLLGIIYNTAGDKWVTVYYGVPVWKEAXTTLFCASDAKAYDT
EAHNIWATHACVPTDPXPQEXELXNVTEDFNMWKNDMVEQMHDDIISLWDQSLKPCVKLT
PLCVTLNCTDVXNXTNXNTTXXGXXMXNCSFNITTXMNNRRKENAMFYNLDIVQLKDDDN
TSYRLISCNTSVVTQACPKITFEPIPIHYCAPAGFAILKCNDKEFNGTGTCRNVSTVQCT
HGIRPVVSTQLLLNGSLAEEEVVIRSANFSNNAKVIIVQLNSSVEINCTRPNNNTRKSIN
MGPGRVFWATGDVIGDIRQAHCNISRTAWRNTLEQIDKKLKEQFKNKTITFNPSSGGDPE
ITMHSFNCGGAMYAPPIKGQIRCSSNITGLMLTRDGGNSGNSSDNSTETFRPAGGDMRDN
WRSELYKYKVVKIEPIGIAPTKAKRRVVQREKRAXGLGAMFLGFLGAAGSTMGAASITLT
XQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARVLAVERYLKDQQLLGIWGC
SGKLICTTAVPWNNSWSNKSLNEIWDNMTWKDWEREIDNYTGLIYTLIENSQIQQEKNEQ
ELLELDKWASLWNWFDITKWLWYIKIFIMIXGGLVGLRIVFTVLSIVNRVRQGYSPLSFQ
THHPGPRGPDRPEGIEXEGGERDRDTSGELVNGFLAIIWVDLRSLCLFSYRRLRDFLLIV
TRIVELLGRRGWETLKYCWNLLQYWSQELXNSAVSLLNTTAIVVAEGTDRIIEALQRIGR
AILNIPRRIRQXLERLLL
Download sequence
Identical sequences A0A076V4T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]