SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076V4Y1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076V4Y1
Domain Number 1 Region: 132-290
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 2.16e-80
Family Retrovirus capsid protein, N-terminal core domain 0.0000000666
Further Details:      
 
Domain Number 2 Region: 2-137
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 9.81e-64
Family Immunodeficiency virus matrix proteins 0.000000787
Further Details:      
 
Domain Number 3 Region: 281-362
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.28e-32
Family Retrovirus capsid protein C-terminal domain 0.0000138
Further Details:      
 
Domain Number 4 Region: 379-430
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 6.16e-17
Family Retrovirus zinc finger-like domains 0.0000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A076V4Y1
Sequence length 501
Comment (tr|A0A076V4Y1|A0A076V4Y1_9HIV1) Gag polyprotein {ECO:0000256|RuleBase:RU004487, ECO:0000256|SAAS:SAAS00998370} KW=Complete proteome OX=11676 OS=Human immunodeficiency virus 1. GN=gag OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MGARASVLSGGELDRWEKIRLRPGGKKQYRLKHIVWASRELERFAVNPSLLETSEGCRQI
LEQLQPALQTGSEELKSLYNLVAVLYCVHQRIEVRDTKEALEKIEEEQNKSKKKAQQAAA
GTGNSSSQVSQNYPIVQNLQGQMVHQALSPRTLNAWVKVVEEKAFSPEVIPMFSALSEGA
TPQDLNTMLNTVGGHQAAMQMLKDTINEEAAEWDRLHPVQAGPIPPGQIREPRGSDIAGT
TSSLAEQIQWMTSNPPIPVGEIYKRWIILGLNKIVRMYSPVSILDIRQGPKEPFRDYVDR
FFKTLRAEQATQEVKGWMTDTLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHK
ARILAEAMSHATHTAIMMQKSNFKGQRRIVKCFNCGKEGHIAKNCRAPRKKGCWKCGREG
HQMKDCSERQANFLGKIWPSHKGRPGNFIQNRPEPTAPPAESFGFGEEITPSPKQEQKTE
GQHPPLVSLKSLFGNDQWSWK
Download sequence
Identical sequences A0A076V4Y1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]