SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076V5B6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076V5B6
Domain Number 1 Region: 154-499
Classification Level Classification E-value
Superfamily gp120 core 6.47e-164
Family gp120 core 0.000000000328
Further Details:      
 
Domain Number 2 Region: 547-672
Classification Level Classification E-value
Superfamily Virus ectodomain 1.31e-56
Family Virus ectodomain 0.0000116
Further Details:      
 
Domain Number 3 Region: 84-135
Classification Level Classification E-value
Superfamily gp120 core 0.00000000000000902
Family gp120 core 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A076V5B6
Sequence length 863
Comment (tr|A0A076V5B6|A0A076V5B6_9HIV1) Glycoprotein 120 {ECO:0000256|HAMAP-Rule:MF_04083} KW=Complete proteome OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MRVMETGKNCQHLWRGGILLLGMLMICSATEQLWVTVYYGVPVWKEATTPLFCASDAKAY
STEAHNVWATHACVPTDPSPQEVRLENVTENFNMWKNNMVEQMHEDIISLWDESLKPCVK
ITPLCVALKCTNYNATNTNRTDTNSTKWKEMEGEIKNCSFNITTQIQNRVRTEYALFNAL
DIVPIDDDKNENTNNSGRSYMLVNCNSSVIKQACPKMSFEPIPIHYCTPAGFALLKCSDK
KFNGTGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEDIVIKSENLTNNAKNIIVQLNES
VEINCTRPNNNTRKSIHTAWGQALYATGEIIGDIRQAHCNLSKAAWEKVLKRIAVKLKEH
FNKTIAFNRSSGGDLEIRMHTFNCGGEFFYCNTSKLFNSTWPNSTLENSTGSNSTQNETI
TLPCRIKQIINRWQEVGRAIYAPPIRGQIKCTSNITGLILTRDGGNSNESTTETFRPGGG
DMRDNWRSELYKYKVVKIEPLGLAPTKAKRRVVQREKRAITLGAMFLGFLGAAGSTMGAA
SLTLTVQARLLLSGIVQQQNNLLRAIEAQQHILQLTVWGVKQLQARVLAVERYLQDQQLL
GIWGCSGKLICTTAVPWNASWSNKSLDDIWENMTWMEWERQIDNYTEEIYKLLEASQNQQ
EKNEQDLLALDKWANLWSWFTLTNWLWYIKIFIMIVGGLIGLRIVFTVISLVNRVRQGYS
PLSFQTRLPTPRGPDGPEGTEEEGGERDRDRSRRLVTGFLPLIWDDLRSLFLFSYHRLRD
LLLILTRIVELLGRRGWETLKYWWNLLQYWGRELKNSAVSLLNFIAIAVAEGTDRIIEAV
QRVVRAFLNIPRRIRQGLERALQ
Download sequence
Identical sequences A0A076V5B6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]