SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076V6G7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076V6G7
Domain Number 1 Region: 160-504
Classification Level Classification E-value
Superfamily gp120 core 1.28e-162
Family gp120 core 0.000000000568
Further Details:      
 
Domain Number 2 Region: 552-677
Classification Level Classification E-value
Superfamily Virus ectodomain 1.68e-57
Family Virus ectodomain 0.00000867
Further Details:      
 
Domain Number 3 Region: 83-135
Classification Level Classification E-value
Superfamily gp120 core 0.0000000000000122
Family gp120 core 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A076V6G7
Sequence length 868
Comment (tr|A0A076V6G7|A0A076V6G7_9HIV1) Glycoprotein 120 {ECO:0000256|HAMAP-Rule:MF_04083} KW=Complete proteome OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MRVRGMQRNWQHLGTWGLLLLGIIXSVTGDSWVTIYYGVPVWKEATTTLFCASDAKAYDK
EAHNIWATHACVPTDPNPQEVDLGNVTEKFNMWKNDMVEQMHDDIISLWDQSLKPCVRLT
PLCVTLNCSNATXVNXTKGSNNVTNGSNNVTNGTXEGGGEMKNCSFDITTXMNKXKXEYA
XFYNLDIVKLEEDGNNSTSTNSTKYRLISCNTSVVTQACPKINFDPIPIHYCAPAGFAIL
KCKDKNFNGTGNCRNVSTVQCTHGIKPXVSTQLLLNGSLAEDEVVIKSANLTNNAKNIIV
QLNQSVEINCTRPNNNTRKSIHMGPGKVFWATGEIIGDIRQAHCTIRKKTWRKALEQIAR
KLREQFTNKAIIFTQASGGDPEIILHHFNCGGEFFYCNTSGLFNGTWNGTWDGTWNDTKL
NDTENITLPCRIKQIINRWQEVGKAMYAPPIQGXIXCSSNITGLILTRDGGDNXTNNETF
RPTGGDMRDNWRSELYKYKVVQIEPIGVAPTRARRRVVQREKRAIGLGAVFLGFLGAAGS
TMGAASITLTVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILALERYLQ
DQQLLGIWGCSGKLICTTNVPWNASWNNRSLNYIWENMTWREWEREIDNYTDLIYTLLEE
SQNQQEKNEQDLLALDKWASLWNWFSITHWLWYIKIFIMIVGGLIGLRIVFTILSIINRV
RQGYSPLSFQTHHPATRGPDRPGEIEEGGGERDRDTSRPLANGFLAIIWVDLRSLCLFSY
HRLRDLLLIVTRTVELLGRRGWETLKYCWNLLQYWSQELKNSAISLLNTTAIVVAEGTDR
IIEALQRAGRAILNIPRRIRQGLERALL
Download sequence
Identical sequences A0A076V6G7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]