SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076V8L8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076V8L8
Domain Number 1 Region: 156-491
Classification Level Classification E-value
Superfamily gp120 core 8.14e-171
Family gp120 core 0.000000000374
Further Details:      
 
Domain Number 2 Region: 538-666
Classification Level Classification E-value
Superfamily Virus ectodomain 8.71e-59
Family Virus ectodomain 0.00001
Further Details:      
 
Domain Number 3 Region: 87-135
Classification Level Classification E-value
Superfamily gp120 core 0.0000000000000667
Family gp120 core 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A076V8L8
Sequence length 857
Comment (tr|A0A076V8L8|A0A076V8L8_9HIV1) Glycoprotein 120 {ECO:0000256|HAMAP-Rule:MF_04083} KW=Complete proteome OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MRARGMQXNWQXLXTWGLLXLXILIICNAKEXEXKLXVTVYYXVPVWKEASTTLFCASDA
KAYDTEAHNVXATHACVPTDPNPQEVKMENVTENFNMWKNDMVEQMHEDIISLXDQSLKP
CVKLTPLCVTLNCADVRNSTHTNSTNSTTEESIMVGEIKNCSFNVTSSINDKPQKENALF
YKLDIVPINDDNTSYRLISCNTSVVTQACPKISFEPIPIHYCAPAGFAILKCNDTKFNGT
GPCSNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIKSENISDNTKVIIVQLNETLKINC
TRPNNNTRKSIHMGPGQAYWATGDIIGDIRQAHCNINEIKWNNTLIQIVKKLREQFKDKK
IIFDQSSGGDPEIVMHSFNCGGEFFYCDTTKLFNRTWESNETLEINNTEGNETIILPCRI
KQIINMWQGVGKAMYAPPIKGKISCSSNITGLILTRDGGVNNTNETFRPGGGNMKDNWRS
ELYKYKVVKLEPLGIAPTKAKRRVVQREKRAIAGAVFLGFLGAAGSTMGAASVTLTVQAR
QLLSGIVQQQSNLLRAIEAQQHMLQLTVWGIKQLQARVLAVERYLKDQQLLGIWGCSGKL
ICTTNVPWNXSWSKSWNRSLDDIWDNMTWMEWEKEIDNYTYTIYNLLEASQNQQEKNEQE
LLALDKWASLWNWFDITNWLWYIKIFIMIVGGLIGLRIVFTVLSIVKRVRQGYSPLSLQT
HLPTQRGPXRPGGIEEEGGERDRDTSGPLVTGFLAIIWVDLRSLCLFSYHRLRDLLLIVA
SIVELLGRRGWEILXXWWNLLQYWSXELKNSAVSLLNTXAIVXAEGTDRILEALQRAGRX
VLNIPRRIRQGLERALI
Download sequence
Identical sequences A0A076V8L8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]