SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076V995 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076V995
Domain Number 1 Region: 153-483
Classification Level Classification E-value
Superfamily gp120 core 1.77e-163
Family gp120 core 0.000000000428
Further Details:      
 
Domain Number 2 Region: 530-654
Classification Level Classification E-value
Superfamily Virus ectodomain 7.48e-57
Family Virus ectodomain 0.0000101
Further Details:      
 
Domain Number 3 Region: 86-141
Classification Level Classification E-value
Superfamily gp120 core 0.00000000000000667
Family gp120 core 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A076V995
Sequence length 846
Comment (tr|A0A076V995|A0A076V995_9HIV1) Glycoprotein 120 {ECO:0000256|HAMAP-Rule:MF_04083} KW=Complete proteome OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MRVKETRKNCQHWWWKWGMMLLGMWMICSAEKEKLWVTVYYGVPVWKEATTTLFCASDAK
AYDTEVHNVWATHACVPTDPSPQEVVLVNVTENFNMWKNNMVEQMHEDIIELWDQSLKPC
VKLTPLCVTLNCTNYNANNSASNNTNVDNAXADIKNCSFNITTGIGNKMKKEYAFFNILD
VTPIEGDNTSYILTSCNTSVITQACPKVNFDPIPIHYCAPAGFAILKCNDKEFNGTGPCK
NVSTVQCTHGIKPVVSTQLLLNGSLAEGEIVIKSSNITNNARNIIVQLNETVRINCTRPN
NNTRKSIHIGPGSAWYTTGEIIGNIRQAHCNISEKDWEKTLRRVAIKLREQFNKTIIFNQ
SLGGDPEIVMHIFNCRGEFFYCNTTRLFNSTWKGNETATNNGTITLPCXIKQFINRWQGV
GXAMYAPPISGNISCSSDITGLLLTRDGGYNNETDSEIFRPAGGDMKDNWRSELYKYKVV
RIEPLGIAPSRAKRRVVQREKRAALGAMFLGFLGAAGSTMGAASLTLTVQARLLLSGIVQ
QQNNLLRAIEAQQHLLQLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICNTAVPW
NASWSNKSLNDIWDNLTWMQWEKEIENYTSIIYTLLEESQNQQEKNEQDLLALDQWANLW
SWFDISNWLWYIKIFIMIVGGLIGLRIVFTVLSIVNRVRQGYSPLSFQTLLPAARGPDRP
DGIEEGGGERDRDESRRLVTGFLAIIWVDLRSLCLFIYHRLRDLLLIVTRTVELLGHRGW
EVLKYLWSLLQYWSQELKKSAVSLLNSTAIVVAEGTDRIIEAARTVGIAILHIPRRIRQG
LERALL
Download sequence
Identical sequences A0A076V995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]