SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076W199 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076W199
Domain Number 1 Region: 16-170
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 6.02e-34
Family SMI1/KNR4-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A076W199
Sequence length 183
Comment (tr|A0A076W199|A0A076W199_BACMY) SMI1 / KNR4 family protein {ECO:0000313|EMBL:AIK36699.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=DJ92_4215 OC=Bacillus cereus group.
Sequence
MGCFDNFDFNNFWDDSEYARDEYISEYPTDEMISKLENELGYKLPESYIWLMKKHNGGIP
INDCFPTDVPTSWAEDHVAITGIYGIGYKKSSSLGGEFGSEFWIEEWGYPEIGVAICDCP
SAGHDMIFLDYRECGPKGEPCVVHIDQEYDYKITWLAKDFESFIRGLVNGEVYDDSEQIK
EEY
Download sequence
Identical sequences A0A076W199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]