SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076WA56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076WA56
Domain Number 1 Region: 137-281
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 9.42e-58
Family AadK C-terminal domain-like 0.0000408
Further Details:      
 
Domain Number 2 Region: 1-133
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.8e-48
Family AadK N-terminal domain-like 0.0000687
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A076WA56
Sequence length 290
Comment (tr|A0A076WA56|A0A076WA56_BACMY) Streptomycin adenylyltransferase family protein {ECO:0000313|EMBL:AIK38690.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=DJ92_4532 OC=Bacillus cereus group.
Sequence
MRSEKEMMGLILNAAREDERIRAVIMNGSRVNPNVKRDCFQDYDIVYVVKDIQSFTSDHS
WINRFGKIMIVQMPEESTLVPPEEDGSFPYLMQFIDGNRIDLTLVSVEIIDEILGGDSLS
VLLFDKDGAIEPFPPANDSDYCIKRPTAKEFADCCNEFWWCSTNVAKGLWREELPYVKGM
LEGPIRNMLMQMLEWHIGIKTNFTVNAGKFGKYFEQYLEDDLWKQYIETFSNADYENIWK
SFFVMGDLFRETAIGIARYFSFEYPQGDDARVTSYLKHVRSLPKDSQTIY
Download sequence
Identical sequences A0A076WA56
WP_018781350.1.26964 WP_018781350.1.38413 WP_018781350.1.91021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]