SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076WC72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076WC72
Domain Number 1 Region: 46-175
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000929
Family SMI1/KNR4-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A076WC72
Sequence length 181
Comment (tr|A0A076WC72|A0A076WC72_BACMY) Syd family protein {ECO:0000313|EMBL:AIK40473.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=DJ92_267 OC=Bacillus cereus group.
Sequence
MEIKKALEHYYKELINVWGTKYGTYPKVPWDEEIDPLLYLSNPDEEEYVYWKPIEKIDLD
NFTEIEKKLGMNIHHAMKEYFNSYWFLSLQGFYGSRLVNLEPVEPGKSILEFFQVMKQYE
EKNGRELRYIQIGFVSPEDMAIIFDNETGQILIENFETEENEFLANSLAELINNLKVELE
V
Download sequence
Identical sequences A0A076WC72 A0A2B6X001
WP_018781746.1.26964 WP_018781746.1.38413 WP_018781746.1.91021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]