SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076WI63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076WI63
Domain Number 1 Region: 9-126
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.88e-19
Family SMI1/KNR4-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A076WI63
Sequence length 217
Comment (tr|A0A076WI63|A0A076WI63_BACMY) SMI1-KNR4 cell-wall family protein {ECO:0000313|EMBL:AIK40817.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=DJ92_247 OC=Bacillus cereus group.
Sequence
MINLSKVPDLIKKTAASDIEIQEVEDRMKVKFPNVYKGLLRCTNGFSIGGGLVIYGTEHI
VERNEVWEVDEYAIGYISIGDDGGGNVFLMSQDAEGKEVLVIDSGDMNPNHATIITSDFN
KWVNSGCLSEIEQKTIIKPSDICNIVLAKTPNEGLTDLIRIKNVLGIEISTADLLKGSKN
PPYILVERFPYGKAKKLIEKLGTSGTVLSIEPIGNNN
Download sequence
Identical sequences A0A076WI63
WP_018781697.1.26964 WP_018781697.1.38413 WP_018781697.1.91021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]