SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077C3R7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077C3R7
Domain Number 1 Region: 51-162
Classification Level Classification E-value
Superfamily LigT-like 0.0000118
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077C3R7
Sequence length 203
Comment (tr|A0A077C3R7|A0A077C3R7_9PROT) Uncharacterized protein {ECO:0000313|EMBL:AIL13062.1} KW=Complete proteome; Reference proteome OX=244581 OS=Candidatus [Caedibacter] acanthamoebae. GN=IM40_05340 OC=Bacteria; Proteobacteria; Alphaproteobacteria; Holosporales.
Sequence
MALNLKIKTLFLIVTIQFLHLTSANATNNLAIKLDVTDQAQGILNKMKTVAGLPQQTHKF
HCTVGFIEGIQSTEAKTLAEKIQAKLQSQLPNPIEFDVNAITRPFNSNIIGLVPTVESRN
KLIEFNKIVANVVKEITQGRYTLNAFTSTNYVPHISLANVAVANPDKALATFNQDLQTMK
ANKKGRFFLKLGTVSHTVMTVKK
Download sequence
Identical sequences A0A077C3R7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]