SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077CW15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077CW15
Domain Number 1 Region: 4-26
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000353
Family CCCH zinc finger 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A077CW15
Sequence length 187
Comment (tr|A0A077CW15|A0A077CW15_9MONO) M2-1 {ECO:0000313|EMBL:AIL23594.1} OX=162145 OS=Human metapneumovirus. GN= OC=Mononegavirales; Pneumoviridae; Metapneumovirus.
Sequence
MSRKAPCKYEVRGKCNRGSECKFNHNYWSWPDRYLLIRSNYLLNQLLRNTDRADGLSIIS
GAGREDRTQDFVLGSTNVVQGYIDDNQSITKAAACYSLHNIIKQLQEVEVRQARDNKLSD
SKHVALHNLILSYMEMSKTPASLINNLKRLPREKLKKLAKLIIDLSAGTDNDSSYALQDS
ESTNQVQ
Download sequence
Identical sequences A0A077CW15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]