SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077D3F2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077D3F2
Domain Number 1 Region: 121-446
Classification Level Classification E-value
Superfamily gp120 core 1.37e-163
Family gp120 core 0.000000000629
Further Details:      
 
Domain Number 2 Region: 50-102
Classification Level Classification E-value
Superfamily gp120 core 0.00000000000000471
Family gp120 core 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077D3F2
Sequence length 446
Comment (tr|A0A077D3F2|A0A077D3F2_9HIV1) Envelope glycoprotein {ECO:0000313|EMBL:AIL25382.1} OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
TVYYGVPVWKEATTTLFCASDAKAYDTGVHNVWATHACVPTDPNPQELELKNVTEDFDMW
KNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLDCTDLTNATNTTGSDTNTTSSGGGLLG
EVKNCSFNVTTSIRDKVQKEYALFYKLDIVPIKDANTNNNSFRLISCNTSVITQACPKVS
FEPIPIHYCAPAGFAILKCNQKNFTGKGTCYNVSTVQCTHGISPVVSTQLLLNGSLAEGE
VIIRSKNFSDNAKTIIVQLNESVVINCTRPNNNTGKRISIGPGRAFVAKRQITGDIRQAH
CNLSRADWNNTLRQVARKLREQFGNKTIAFNQSSGGDPEVVMHNFNCGGEFFYCNTTQLF
NSTWHNNDTSPNAGGDDKIILPCRIKQIINMWQEVGKAMYAPPIRGQINCSSNITGLLLV
RDGGNNGNNSNTEIFRPGGGNMRDNW
Download sequence
Identical sequences A0A077D3F2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]