SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077D4G2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077D4G2
Domain Number 1 Region: 158-259
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.18e-21
Family Gelsolin-like 0.0011
Further Details:      
 
Domain Number 2 Region: 53-155
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 7.01e-17
Family Gelsolin-like 0.0014
Further Details:      
 
Domain Number 3 Region: 7-65
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0000467
Family Gelsolin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077D4G2
Sequence length 259
Comment (tr|A0A077D4G2|A0A077D4G2_9HYME) Gelsolin {ECO:0000313|EMBL:AIL27383.1} OX=1384826 OS=Dolerus eversmanni. GN=GLN OC=Tenthredinidae; Dolerinae; Dolerus.
Sequence
FTFSLQKKFKSLFGEKLEVVRTHQQQENLKFMAHFKRKFIIRQGRRKQPKSPANNKVEFY
HLRSNGSALCTRLIQVNPDACLLNSAFCYILNVPFNNDDETGIVYVWIGSKADSEEARLV
EEIAEEMFNNPWISLQVLNEGEEPDNFFWVGIGGKKPYDTNADYMNYTRLFRCSNEKGYF
TISEKCTDFCQDDLADDDIMVLDNGEQVFLWLGARCSEVEIKLAFKSAQVYIQHLRVKQP
ERPRKLFLTAKSKESRRFT
Download sequence
Identical sequences A0A077D4G2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]