SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077ECI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077ECI9
Domain Number 1 Region: 171-334
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000209
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077ECI9
Sequence length 354
Comment (tr|A0A077ECI9|A0A077ECI9_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:AIL45157.1} KW=Complete proteome; Reference proteome OX=1338011 OS=Elizabethkingia anophelis NUHP1. GN=BD94_1382 OC=Flavobacteriaceae; Elizabethkingia.
Sequence
MTRICFTADRFDINGNSIALPLPINELESILGEARVFTGEYNTVYTWPELGIKAYSKERK
LVETVDVVFEPEDYEHSPEKVFTGELLLNGTDIKEYYINNKDKRVKLWDDDPNGAFVFNN
HSLWLDIEDGVFNTVSIEAYTKKGEAKTLESLPLDAGFEDLAVIWNKWIAAIKEYVDEDN
AYYNLTHGITAGQMHETEVQLEVPLPGVLLNFYKVHNVRWNAVTSAFSFSVNGWSYDLLP
FEKIIDEWEEIQDLNDDEVLGAEMKEGYSDNVKAVNYANPKWIPFAEGRNGDYLLIDTDP
SEKGTFGQIIELQNEGWTRSVVASSLEELITQEIEIIKSEGNNRFGFIQENGKF
Download sequence
Identical sequences A0A077ECI9
WP_024565037.1.12545 WP_024565037.1.15723 WP_024565037.1.32871 WP_024565037.1.56507 WP_024565037.1.72953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]