SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077EHX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077EHX1
Domain Number 1 Region: 5-159
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000275
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077EHX1
Sequence length 205
Comment (tr|A0A077EHX1|A0A077EHX1_9FLAO) PXO1-97 {ECO:0000313|EMBL:AIL46108.1} KW=Complete proteome; Reference proteome OX=1338011 OS=Elizabethkingia anophelis NUHP1. GN=BD94_2333 OC=Flavobacteriaceae; Elizabethkingia.
Sequence
MKWEFTKTLKNINSIAQVEYEFGKELPKDYKDLIIEYNSGSPNPNTLDTKNKKGKAFGEL
LNFNLDEKDNILDNYSWIKDKLPSKVFPITVTPGGDYLCYDYRESSENPCIIYWDHEQNF
NIVDGEIETLDTPHEYQKYSLDFVSNNMTELLAKLYDDIDEIDTSGFVTIWEDFLNEDEL
RELSDQDLADVNNRRSKEGLPPIVK
Download sequence
Identical sequences A0A077EHX1 A0A1T3DSS7 A0A290N568
WP_009088365.1.12545 WP_009088365.1.13392 WP_009088365.1.14670 WP_009088365.1.15723 WP_009088365.1.20431 WP_009088365.1.23011 WP_009088365.1.32871 WP_009088365.1.33535 WP_009088365.1.37574 WP_009088365.1.44679 WP_009088365.1.56507 WP_009088365.1.62611 WP_009088365.1.68229 WP_009088365.1.68467 WP_009088365.1.68736 WP_009088365.1.72953 WP_009088365.1.74790 WP_009088365.1.75865 WP_009088365.1.76746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]