SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077ELC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077ELC2
Domain Number 1 Region: 4-148
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000131
Family SMI1/KNR4-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A077ELC2
Sequence length 151
Comment (tr|A0A077ELC2|A0A077ELC2_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:AIL47278.1} KW=Complete proteome; Reference proteome OX=1338011 OS=Elizabethkingia anophelis NUHP1. GN=BD94_3503 OC=Flavobacteriaceae; Elizabethkingia.
Sequence
MEIKYLKKMKDTPKIGQWVNRGISEQKIEKLEQEFNISFPQAYKEFLYLGGDFQNCVEWD
TNYVHIDWTQDNVKDSMANVNLQLKPFFAFGEYGCDQCLFFFLNDGENPPIYVYAEDKVH
QNEKGEFVYYVKQDNFFSEYIDRCIDEALKK
Download sequence
Identical sequences A0A077ELC2
WP_024566340.1.12545 WP_024566340.1.14670 WP_024566340.1.15723 WP_024566340.1.32871 WP_024566340.1.56507 WP_024566340.1.62611 WP_024566340.1.68467 WP_024566340.1.72953 WP_024566340.1.74790 WP_024566340.1.76746 WP_024566340.1.8955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]