SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077ERZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077ERZ6
Domain Number 1 Region: 36-152
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 1.18e-57
Family Retrovirus capsid protein, N-terminal core domain 0.000000423
Further Details:      
 
Domain Number 2 Region: 2-41
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 0.000000259
Family Immunodeficiency virus matrix proteins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A077ERZ6
Sequence length 152
Comment (tr|A0A077ERZ6|A0A077ERZ6_9HIV1) Gag protein {ECO:0000313|EMBL:AIL48244.1} OX=11676 OS=Human immunodeficiency virus 1. GN=gag OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
YTKEALEKIEEEQNKSKKKAQQAAADTGNSSHVSQNYPIVQNLQGQMVHQVISPRTLNAW
VKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRL
HPVHAGPIAPGQMREPRGSDIAGTTSTLQEQI
Download sequence
Identical sequences A0A077ERZ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]