SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077FJX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077FJX3
Domain Number 1 Region: 148-257
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000942
Family Pseudo ankyrin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077FJX3
Sequence length 410
Comment (tr|A0A077FJX3|A0A077FJX3_9RICK) Uncharacterized protein {ECO:0000313|EMBL:AIL64820.1} KW=Complete proteome; Reference proteome OX=1528098 OS=Rickettsiales bacterium Ac37b. GN=NOVO_02125 OC=Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales.
Sequence
MLNQNQSMLNDSEKLMEKVREISPKILPADMSIEDKLIYILKEACEEQDIKTINALWNLK
EVFIRRLFDDEYKDIFIKALDKEKENVLEALLNLEMYICQHRRILQSGDNYIFRTLAAKG
YLEIIKKITKDLDSYDIREMVSAKNYEAFRAAAYHGHIAVLEFLLELAPALLPEAMIYAV
GKAFRFAAENAHIAVLEFLLNRTPVFQREAMMHCKVDDTFRGAAFKGHIKVLELLVKSIP
DSKKQKEMICSNNDEIFHRNITSKPIMQFLLSLVPEKWKTIKEDNFSYYYSSKILENSIE
FIQKLSKVPIEFPQIAISTILNMQKFASKIYNFILSSKTIMMLLAEPAMNSMLCALDDTK
SDLLEYDRRCVVKAMQTISNDNEPKPEVCFVDKILKEKFPEKIDNLLLSK
Download sequence
Identical sequences A0A077FJX3
WP_038602175.1.52455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]