SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077FLU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077FLU9
Domain Number 1 Region: 1-53
Classification Level Classification E-value
Superfamily Rubredoxin-like 4.54e-23
Family Rubredoxin 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077FLU9
Sequence length 55
Comment (tr|A0A077FLU9|A0A077FLU9_9PSED) Rubredoxin {ECO:0000256|PIRNR:PIRNR000071} KW=Complete proteome OX=237609 OS=Pseudomonas alkylphenolica. GN=PSAKL28_51810 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKKWQCIVCGLIYDEAEGWPDDGIAPGTRWEDVPADWLCPDCGVGKMDFEMIAIG
Download sequence
Identical sequences A0A077FLU9
WP_028942479.1.42120 WP_028942479.1.97771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]