SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077FM20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077FM20
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.11e-29
Family SMI1/KNR4-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077FM20
Sequence length 158
Comment (tr|A0A077FM20|A0A077FM20_9RICK) SMI1-KNR4 cell wall assembly regulator protein {ECO:0000313|EMBL:AIL66123.1} KW=Complete proteome; Reference proteome OX=1528098 OS=Rickettsiales bacterium Ac37b. GN=NOVO_09045 OC=Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales.
Sequence
MSYADYKEAINWIKNNEEKCFIRKGNTIDEINKAEKKLVIELPKSYKEFLSKYGYWSCDS
KEIYGLYNNTLIDFTIDQRNVNHDYKFPLGFVPIHELGNGEKSCLDTSQMNEEGECPVVA
WYFGPTLPNGKCEILAEDFGAFLLDKVKSAIESLEEEE
Download sequence
Identical sequences A0A077FM20
WP_038604171.1.52455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]