SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077H237 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077H237
Domain Number 1 Region: 156-523
Classification Level Classification E-value
Superfamily gp120 core 5e-159
Family gp120 core 0.000000000601
Further Details:      
 
Domain Number 2 Region: 570-695
Classification Level Classification E-value
Superfamily Virus ectodomain 6.88e-58
Family Virus ectodomain 0.00000895
Further Details:      
 
Domain Number 3 Region: 84-136
Classification Level Classification E-value
Superfamily gp120 core 0.00000000000000169
Family gp120 core 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077H237
Sequence length 886
Comment (tr|A0A077H237|A0A077H237_9HIV1) Glycoprotein 120 {ECO:0000256|HAMAP-Rule:MF_04083} OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MRAKGIRKNCQHLWRWGIMLLGMLMICSAGEQLWVTVYYGVPVWKEANTTLFCASDAKAY
DTEAHNVWATHACVPTDPNPQEVELENVTEYFNMWKNNMVEQMHEDIISLWDQSLKPCVK
LTPLCVTLDCTNVTYTPNNNCTTSNRTVNATREDGDMKNCSFNITTSIKNKMQKEYALFY
KLDITPIDPDKKKNKKGNGTDDTKSYMLISCNTSVVTQACPKISFEPIPIHYCAPAGFAI
LKCKDKNFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEDEVMIRSRNFSENADNII
VQLNKSIAINCTRPNNNTSKGIHMGPGRAFYATGRIIGDMRQAHCNLSRGDWWSALKQIV
TKLGEQYRNKTTIIFNQSSGGDPEIVRHSFNCGGEFFYCDTTNLLNSTWTRNKTGIWNNT
AGIWNDTAKEWTWNNDTGTEPITLQCRIKQIINRWQKVGKAMYAPPISGLINCSSNITGL
ILARDGGSGNDSSNGTETFRPIGGNMKDNWRSELYKYKVVKIEPLGIAPTRAKRRVVQRE
KRAAIGAMFLGFLGAAGSTMGAASLTLTVQARLLLSGIVQQQNNLLRAIEAQHHMLQLTV
WGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICHTAVPWNTTWSSKSHDAIWNNMTWMQ
WEKEIDNYTNIIYDLLEKSQNQQEKNEQELLELDKWASLWNWFDITQWLWYIRIFIMIVG
GLIGLRIIFAVLSIVNRVRQGYSPLSFQIRPPTPRGPDRPEGIEEEGGERDRDRSERLVT
GFLPLIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNS
AVSLLNATAIAVAEGTDRIIEVVQRICRAILNIPRRIRQGLERALL
Download sequence
Identical sequences A0A077H237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]