SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077H2S4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077H2S4
Domain Number 1 Region: 156-491
Classification Level Classification E-value
Superfamily gp120 core 9.81e-173
Family gp120 core 0.000000000283
Further Details:      
 
Domain Number 2 Region: 540-665
Classification Level Classification E-value
Superfamily Virus ectodomain 4.65e-58
Family Virus ectodomain 0.0000107
Further Details:      
 
Domain Number 3 Region: 84-129
Classification Level Classification E-value
Superfamily gp120 core 0.0000000000000471
Family gp120 core 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077H2S4
Sequence length 856
Comment (tr|A0A077H2S4|A0A077H2S4_9HIV1) Glycoprotein 120 {ECO:0000256|HAMAP-Rule:MF_04083} OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MRVTEIRKNYQQWWRGVTLLLGILMISCDAEQAWVTVYYGVPVWKEATTTLFCASDAKAY
KKEVHNVWATHACVPTDPNPQELVLANVTEDFNMWKNGMVEQMHEDIISLWDQSLKPCVK
LTPLCVSLNCSEPRLNATSGKGHTNTSSIPILDEREIKNCSFNTTTSIRDKMQENYALFY
TMDIVPIDDKNGTKYRLISCNTSVIRQACPKVSFEPIPIHYCAPAGFAILKCNNKTFSGK
GPCTNVSTVQCTHGIRPVVSTHLLLNGSLAEKEVVIRSDNFSDNAKTIIVHLNETVNITC
IRPGNNTRRSIHIGPRAAIYATGQIIGDIRQAHCNISRAEWNNTLIKVVKKLREQFKNKT
IVFDQSSGGDPEIVMHTFNCGGEFFYCNSTQLFNSTWLSNGTWNETEAKGDNITLLCRIK
QIINVWQEVGKAMYAPPIRGQIKCTSNITGLLLTRDGGNNETTIETFRPGGGNMKDNWRS
ELYKYKVVKVEPLGLAPTKAKRRVVQREKRAIGGLGALFLGLLGAAGSTMGAASLTLTVQ
ARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSG
KLICSTNVPWNNSWSNKSLTEIWDNMTWMQWEKEIDNYTDEIYKLLAESQFQQEKNEQEL
LKLDKWASLWNWFDITSWLWYIKIFIMIVGGLIGLRIVFAVLSIVNRVRQGYSPLSFQTR
LPAPRGPDRPDGTEEEGGERDRDRSTRLVDGFLALIWDDLRSLFLFSYHRLRDLLLIVTR
IVELLGRRGWEILKYWWNLLQYWSQELKNSAVSLFNATAIAVAEGTDRVIEVVRRIFRGV
LHVPRRIRQGFERALL
Download sequence
Identical sequences A0A077H2S4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]