SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077KPV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077KPV2
Domain Number 1 Region: 46-174
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.35e-20
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077KPV2
Sequence length 177
Comment (tr|A0A077KPV2|A0A077KPV2_9FLAO) Putative glucan synthasis protein {ECO:0000313|EMBL:BAP33831.1} KW=Complete proteome OX=878220 OS=Chryseobacterium sp. StRB126. GN=CHSO_4794 OC=Flavobacteriaceae; Chryseobacterium.
Sequence
MEELNHEEIKIKEIVDRTLNFWVENELNQLPCDIEKEMLAQDQPDEEWKFWLPVTSTVTD
TELQEFEAETGFVFPDNFKIFLKHKHFYELQISEVSFCSLPVSSWRASLREMMFETYSRE
FLFDKGYIPFAVYSDWGLLCFDSHNNNAVVLWDHEDENSFQYQYSNFYELLTEISKA
Download sequence
Identical sequences A0A077KPV2
WP_045501533.1.36240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]