SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077KZ20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077KZ20
Domain Number 1 Region: 4-106
Classification Level Classification E-value
Superfamily ISP domain 8.77e-23
Family Rieske iron-sulfur protein (ISP) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077KZ20
Sequence length 109
Comment (tr|A0A077KZ20|A0A077KZ20_ACIGI) Putative Rieske iron-sulfur protein {ECO:0000313|EMBL:BAP37405.1} OX=106649 OS=Acinetobacter guillouiae (Acinetobacter genomosp. 11). GN=AS4_24650 OC=Moraxellaceae; Acinetobacter.
Sequence
MSEKIAMTDEIEERKARAFDTMTGDTIFITQRDGAFYAYQNVCPHLQTELEFLENQFLDQ
DGEYIQCSTHGALFEVETGECISGPCLGDKLEKVNISVHSDGGIYIEDE
Download sequence
Identical sequences A0A077KZ20 A0A0Q7FPZ9 N8S841 N8YA82
WP_004719682.1.15248 WP_004719682.1.19192 WP_004719682.1.22718 WP_004719682.1.25018 WP_004719682.1.53393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]