SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077L3Y8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077L3Y8
Domain Number 1 Region: 42-163
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000589
Family SMI1/KNR4-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077L3Y8
Sequence length 201
Comment (tr|A0A077L3Y8|A0A077L3Y8_ACIGI) Uncharacterized protein {ECO:0000313|EMBL:BAP37778.1} OX=106649 OS=Acinetobacter guillouiae (Acinetobacter genomosp. 11). GN=AS4_28380 OC=Moraxellaceae; Acinetobacter.
Sequence
MIEIDHKTDIIIPFNKIGEPEWDVKTRLILESLADLNDDEIAPAIDDEQILKLEQRLNCR
LPESLKIFYQHFGIADIGEQLQQFDDIGYLKDIWANAPQYAPEFSQADLAVLPHLITFSD
YLGNGNMFCFHDISKEIYYFDHDDTPYLSKILECVDDYIKGCLILVQSEFFAEAHPDEVD
EWVEDRFIALFNEQTLKKWRY
Download sequence
Identical sequences A0A077L3Y8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]