SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077L6T2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077L6T2
Domain Number 1 Region: 2-42
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.000000000262
Family Blood coagulation inhibitor (disintegrin) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077L6T2
Sequence length 117
Comment (tr|A0A077L6T2|A0A077L6T2_PROFL) Metalloprotease P-III 3 {ECO:0000313|EMBL:BAP39965.1} OX=88087 OS=Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis). GN= OC=Protobothrops.
Sequence
AEGLCCDQCRFKGAGTECRAATDECDMADLCTGRSAECTDRFQRNGQPCQNNNGYCYNGT
CPTMNNQCIALFGPNAAVSQDACFQFNRQGNYYGYCRKEQNTKIACEPQNVKCGRLY
Download sequence
Identical sequences A0A077L6T2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]