SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077LER2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077LER2
Domain Number 1 Region: 136-187
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000314
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077LER2
Sequence length 195
Comment (tr|A0A077LER2|A0A077LER2_9PSED) KNR4-like cell wall assembly/cell proliferation coordinating protein {ECO:0000313|EMBL:BAP42497.1} KW=Complete proteome; Reference proteome OX=1028989 OS=Pseudomonas sp. StFLB209. GN=PSCI_1795 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSIVDTYLTGLYQALPAQDLEQLKHSHGASEADLSRLLARYPQAPASLLELLGRLDGTHF
RKYPNGEVFVLVLGSDVFEYPYYLSSVEQILEEAGQYNDSIADVYGDYVDEDPELLDPAI
DGQLAMGERLCFSQCMNNGGTSRLYIDFNPAAGGSVGQVVRYLHDPDSYKVIAASFDDYL
KQLVDQNYEFIFEDE
Download sequence
Identical sequences A0A077LER2
WP_045485450.1.88027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]