SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077LVF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077LVF3
Domain Number 1 Region: 61-178
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 5.96e-26
Family AadK C-terminal domain-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077LVF3
Sequence length 203
Comment (tr|A0A077LVF3|A0A077LVF3_9MICO) Similar to streptomycin adenyltransferase {ECO:0000313|EMBL:CCH75960.1} KW=Complete proteome; Reference proteome OX=1194083 OS=Tetrasphaera japonica T1-X7. GN=BN12_10107 OC=Tetrasphaera.
Sequence
MERTENDNGQPTRLIYFTGGKLDFTLITADELATATYERPFTVLLDKDGQARSLHCVPPQ
RSLPDAESFHTCVNEAYAAALMCAKAVVRDELWPAKIRDEDLKWNLLQMIEWDHLARYGT
AYDTRYHARRMNEWMDTDVRTQLLGCWGHLDATDTVAALRRTVDLFARLAERTAALCEIA
PFDHDGLHEEIELILSYPARTPG
Download sequence
Identical sequences A0A077LVF3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]