SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077NFD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A077NFD3
Domain Number - Region: 6-77
Classification Level Classification E-value
Superfamily t-snare proteins 0.00118
Family t-snare proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077NFD3
Sequence length 80
Comment (tr|A0A077NFD3|A0A077NFD3_XENBV) Cell division protein ZapB {ECO:0000256|HAMAP-Rule:MF_01196, ECO:0000256|SAAS:SAAS00371340} KW=Complete proteome OX=1398200 OS=Xenorhabdus bovienii str. feltiae Moldova. GN=XBFM1_1910013 OC=Morganellaceae; Xenorhabdus.
Sequence
MSFEVFEKLESKVQQAIDTITLLQMEIEELKERNAALSQDIQSAASSHDSLVRENEQFKQ
EQLAWQERLRTLLGKMEDVQ
Download sequence
Identical sequences A0A077N8Q4 A0A077NFD3 A0A077NMA8 A0A077P1N9 A0A077P8D5 A0A077Q0U1 A0A077QFU6 D3V6W2
gi|290477232|ref|YP_003470149.1| WP_012990533.1.33677 WP_012990533.1.44656 WP_012990533.1.58494 WP_012990533.1.63801 WP_012990533.1.67706 WP_012990533.1.73871 WP_012990533.1.84134 WP_012990533.1.87433 WP_012990533.1.88548 WP_012990533.1.96151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]