SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077P056 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077P056
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000101
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077P056
Sequence length 176
Comment (tr|A0A077P056|A0A077P056_XENBV) Uncharacterized protein {ECO:0000313|EMBL:CDH07872.1} KW=Complete proteome OX=1398202 OS=Xenorhabdus bovienii str. oregonense. GN=XBO1_610003 OC=Morganellaceae; Xenorhabdus.
Sequence
MTKTELIEYLHSAYPELTIDTNYIKGYSEEDILKLESLRDFKIQGQLREFLTYMGRCSGG
LFGSQPLKFYPEIVNPKGKEIYQSECRKDLVEIEGEDILNQKPFFISIENEGIYDYFLLT
DSDSPDLVYYIDNNYNTIVDTGLTFNKYLRSVVDSSRSYIYKVPTYQEGDLIKLYS
Download sequence
Identical sequences A0A077P056
WP_038253394.1.87433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]